Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1kioA_

Fold library idPDB HeaderMoleculeTitle
c1kioA_PDB header: hydrolaseChain: A: PDB Molecule: serine protease inhibitor i;PDBTitle: solution structure of the small serine protease inhibitor2 sgci[l30r, k31m]


Added to library: Thu Jan 10 03:30:25 2013
 
Links to external resources


 1........10.........20.........30.....
Sequence EVTCEPGTTFKDKCNTCRCGSDGKSAACTRMACPQ
Predicted secondary structure






















SS confidence


































Known secondary structure (DSSP)


S
SS

BTTB


SSSS
B

S






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D