Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1k9aB_

Fold library idPDB HeaderMoleculeTitle
c1k9aB_PDB header: transferaseChain: B: PDB Molecule: carboxyl-terminal src kinase;PDBTitle: crystal structure analysis of full-length carboxyl-terminal2 src kinase at 2.5 a resolution


Added to library: Tue Mar 16 12:53:28 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IQASWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S


TT
SS
B

SSTTB

B
TT

SSTT
TTS
GGG





 .........80.........90.........100.........110.........120.........130.........140
Sequence GTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SSSS
TTB

S

T
S

TT

SSSTT
TTTTSSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
BSS

TTSSS


SB


SS
TT
B

GGG

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTSS
TTSTT


TTB


SSS



TT
B
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEAGKLPVKWTAPEALR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT

TT
B
S


GGG
TT




TT
B





TTTS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence EKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMKNCWHLDAAT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT


TTT

SSTTS
TTTTTT





TT

T
SSGGG
 .........430.........440.
Sequence RPTFLQLREQLEHIRTHELHL
Predicted secondary structure





SS confidence




















Known secondary structure (DSSP) S

TTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D