Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1k5dL_

Fold library idPDB HeaderMoleculeTitle
c1k5dL_PDB header: signaling protein/signaling activatorChain: L: PDB Molecule: ran gtpase activating protein 1;PDBTitle: crystal structure of ran-gppnhp-ranbp1-rangap complex


Added to library: Tue Mar 16 13:15:32 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARFSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKDLEIAEFSDIF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TT


S


SGGG
TT



SS
TT
TT



S

 .........80.........90.........100.........110.........120.........130.........140
Sequence TGRVKDEIPEALRLLLQALLKCPKLHTVRLSDNAFGPTAQEPLIDFLSKHTPLEHLYLHNNGLGPQAGAK
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TT

TTTTT
TT



S


SGGG
TT



S



 .........150.........160.........170.........180.........190.........200.........210
Sequence IARALQELAVNKKAKNAPPLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKMVQNGIRPEGIEHLLLEG
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TTT






SS

TGGG
TT



S



T
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAYCQELKVLDLQDNTFTHLGSSALAIALKSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQTLRL
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP) GGG
TT


TTS

GGG
TT


TT




SS




 .........290.........300.........310.........320.........330.........340....
Sequence QYNEIELDAVRTLKTVIDEKMPDLLFLELNGNRFSEEDDVVDEIREVFSTRGRGELDELDDMEE
Predicted secondary structure

































SS confidence































































Known secondary structure (DSSP)
SS

B
TT


TTSBS
TTST






TT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D