Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1h6uA_

Fold library idPDB HeaderMoleculeTitle
c1h6uA_PDB header: cell adhesionChain: A: PDB Molecule: internalin h;PDBTitle: internalin h: crystal structure of fused n-terminal2 domains.


Added to library: Tue Mar 16 12:11:08 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSITQPTAINVIFPDPALANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLEL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



S


STT
SSTTS
T


TTS




TTGGG
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence KDNQITDLAPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQ
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
SS




GGGTT

S



S


S

GGGTT
TT


TTS




GGGTT
TT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLKNNQISDV
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)



GGGGG
TT



SS




GGGTT
TT



SS




GGGGG
TT


TTS


B
 .........220.........230.........240.........250.........260.........270.........280
Sequence SPLANTSNLFIVTLTNQTITNQPVFYNNNLVVPNVVKGPSGAPIAPATISDNGTYASPNLTWNLTSFINN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) GGGTT
TT






S


B
TTS
B


SGGG
TT
SS

S
 .........290.........300........
Sequence VSYTFNQSVTFKNTTVPFSGTVTQPLTE
Predicted secondary structure








SS confidence



























Known secondary structure (DSSP)
SS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D