Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1dgjA_

Fold library idPDB HeaderMoleculeTitle
c1dgjA_PDB header: oxidoreductaseChain: A: PDB Molecule: aldehyde oxidoreductase;PDBTitle: crystal structure of the aldehyde oxidoreductase from2 desulfovibrio desulfuricans atcc 27774


Added to library: Tue Mar 16 12:27:11 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence METKTLIVNGMARRLLVSPNDLLVDVLRSQLQLTSVKVGCGKGQCGACTVILDGKVVRACIIKMSRVAEN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TTB


TT
BTT

TTS

SSSSSSS
TTTTGGG
BGGGS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASVTTLEGIGAPDCLHPLQHAWIQHGAAQCGFCTPGFIVSAKALLDENVAPSREDVRDWFQKHHNICRCT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

GGGT
BTTB

T

SS
TT
SS

TT


SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GYKPLVDAVMDAAAILRGEKTVEEISFKMPADGRIWGSSIPRPSAVAKVTGLAEFGADAALRMPENTLHL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
STTSS
S



TT


TTS



TTT


BGGGS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ALAQAKVSHALIKGIDTSEAEKMPGVYKVLTHKDVKGKNRITGLITFPTNKGDGWERPILNDSKIFQYGD
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SSSS
STT
GGG

S
S

SS

TT
SS
S

SS
SS
STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence ALAIVCADSEANARAAAEKVKFDLELLPEYMSAPEAMAPDAIEIHPGTPNVYYDQLEEKGEDTVPFFNDP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSTT





SSTT


SBTTB
SSS
SS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence ANVVAEGSYYTQRQPHLPIEPDVGYGYINEQGQVVIHSKSVAIHLHALMIAPGLGLEFPKDLVLVQNTTG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS






SS


TTS


S
T

TTTT
B
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence GTFGYKFSPTMEALVGVAVMATGRPCHLRYNYEQQQNYTGKRSPFWTTMRYAADRQGKILAMETDWSVDH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTGGGS
SS
S


SS
B



TTS

 .........500.........510.........520.........530.........540.........550.........560
Sequence GPYSEFGDLLTLRGAQYIGAGYGIANIRGTGRTVATNHCWGAAFRGYGAPESEFPSEVLMDELAEKLGMD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S

TTTTTTB

S

SS

B


TTTTT

 .........570.........580.........590.........600.........610.........620.........630
Sequence PFELRALNCYREGDTTSSGQIPEVMSLPEMFDKMRPYYEESKKRVKERSTAEIKRGVGVALGVYGAGLDG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) B

TT


TTS


S


TT

SSSSSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence PDTSEAWVELNDDGSVTLGNSWEDHGQGADAGSLGTAHEALRPLGITPENIHLVMNDTSKTPNSGPAGGS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S

TTS




SSS
TGGGT

GGGSBTTTS




S
TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence RSQVVTGNAIRVACEMLIEGMRKPGGGFFTPAEMKAEGRPMRYDGKWTAPAKDCDAKGQGSPFACYMYGL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTTTB
SSSSB

TT



S
B


TTS
SB

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence FLTEVAVEVATGKATVEKMVCVADIGKICNKLVVDGQIYGGLAQGVGLALSEDYEDLKKHSTMGGAGIPS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTT
BS
S
T



STTTTSSTTTTT


 .........850.........860.........870.........880.........890.........900......
Sequence IKMIPDDIEIVYVETPRKDGPFGASGVGEMPLTAPHAAIINGIYNACGARVRHLPARPEKVLEAMP
Predicted secondary structure

































SS confidence

































































Known secondary structure (DSSP) GGGS
S





TTSGGGB


TTGGGSSS



BS


T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D