Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1dcqA_

Fold library idPDB HeaderMoleculeTitle
c1dcqA_PDB header: metal binding proteinChain: A: PDB Molecule: pyk2-associated protein beta;PDBTitle: crystal structure of the arf-gap domain and ankyrin repeats2 of papbeta.


Added to library: Tue Mar 16 13:14:01 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
STTTTB
TTT

BS

TTTT

TTT

TTTS


GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence AKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTRD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S
TTT

SSS

S

TT

TT
TTS


SSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYC
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT

TTSB


SS
SSTT
B

TTT
S
TT


TT


 .........220.........230.........240.........250.........260.........270......
Sequence CLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLL
Predicted secondary structure




























SS confidence

































































Known secondary structure (DSSP) TT
TT

TT


TTS

TT
TT


SS










Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D