Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1c4cA_

Fold library idPDB HeaderMoleculeTitle
c1c4cA_PDB header: oxidoreductaseChain: A: PDB Molecule: protein (fe-only hydrogenase);PDBTitle: binding of exogenously added carbon monoxide at the active2 site of the fe-only hydrogenase (cpi) from clostridium3 pasteurianum


Added to library: Tue Mar 16 12:42:49 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKTIIINGVQFNTDEDTTILKFARDNNIDISALCFLNNCNNDINKCEICTVEVEGTGLVTACDTLIEDGM
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TT



BTS




SS
BTTB

SSS


TTTTTTTS
B

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IINTNSDAVNEKIKSRISQLLDIHEFKCGPCNRRENCEFLKLVIKYKARASKPFLPKDKTEYVDERSKSL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SS
STT



TTT
TTGGG
SSST


SS



S

GGG

SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TVDRTKCLLCGRCVNACGKNTETYAMKFLNKNGKTIIGAEDEKCFDDTNCLLCGQCIIACPVAALSEKSH
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTS




TS


STTSGGG

GGGSS





SSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence MDRVKNALNAPEKHVIVAMAPSVRASIGELFNMGFGVDVTGKIYTALRQLGFDKIFDINFGADMTIMEEA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TT

TTGGGTGGGGGT

SS


TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence TELVQRIENNGPFPMFTSCCPGWVRQAENYYPELLNNLSSAKSPQQIFGTASKTYYPSISGLDPKNVFTV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTT
SS




T
GGGTTTB
SB

TTSS

GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence TVMPCTSKKFEADRPQMEKDGLRDIDAVITTRELAKMIKDAKIPFAKLEDSEADPAMGEYSGAGAIFGAT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
ST
TTSTTS
STT

GGG






GGGT


TTTST
 .........430.........440.........450.........460.........470.........480.........490
Sequence GGVMEAALRSAKDFAENAELEDIEYKQVRGLNGIKEAEVEINNNKYNVAVINGASNLFKFMKSGMINEKQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTS

S



GGG
SS
STTSTTGGGSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence YHFIEVMACHGGCVNGGGQPHVNPKDLEKVDIKKVRASVLYNQDEHLSKRKSHENTALVKMYQNYFGKPG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SSSTTSGGG
TTS



TT


S

SGGG
T
STT
 .........570....
Sequence EGRAHEILHFKYKK
Predicted secondary structure



SS confidence













Known secondary structure (DSSP) STSB





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D