Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionC6Y4C8
DateSun Jul 8 11:45:10 BST 2012
Unique Job IDe2dcdd7fe94cf7f9

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2w8aC_
Top template information
PDB header:membrane protein
Chain: C: PDB Molecule:glycine betaine transporter betp;
PDBTitle: crystal structure of the sodium-coupled glycine betaine2 symporter betp from corynebacterium glutamicum with bound3 substrate
Confidence and coverage
Confidence: 19.2% Coverage: 74%
65 residues ( 74% of your sequence) have been modelled with 19.2% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MERKSQVSDTNNNSIPTNVLLKFVGFSVALFTLPLITYFWTLKTLFKGYQTLYAGLSAAV
Secondary structure 


















SS confidence 



























































Disorder  ???????????????












































Disorder confidence 



























































 
   .........70.........80........
Sequence  MVNIILALYIVAAFREDSGTPKKDIKRE
Secondary structure 






SS confidence 



























Disorder 














?????




???
Disorder confidence 



























 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 2w8a chain C

3D model

Region: 24 - 88
Aligned: 65
Modelled: 65
Confidence: 19.2%
Identity: 14%
PDB header:membrane protein
Chain: C: PDB Molecule:glycine betaine transporter betp;
PDBTitle: crystal structure of the sodium-coupled glycine betaine2 symporter betp from corynebacterium glutamicum with bound3 substrate

Phyre2

PDB 2l6w chain B

3D model

Region: 52 - 79
Aligned: 28
Modelled: 28
Confidence: 6.0%
Identity: 14%
PDB header:membrane protein
Chain: B: PDB Molecule:beta-type platelet-derived growth factor receptor;
PDBTitle: pdgfr beta-tm

Phyre2
1

c2w8aC_
2

c2l6wB_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c2w8aC_



19.2 14 PDB header:membrane protein
Chain: C: PDB Molecule:glycine betaine transporter betp;
PDBTitle: crystal structure of the sodium-coupled glycine betaine2 symporter betp from corynebacterium glutamicum with bound3 substrate
2c2l6wB_



6.0 14 PDB header:membrane protein
Chain: B: PDB Molecule:beta-type platelet-derived growth factor receptor;
PDBTitle: pdgfr beta-tm

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite

Transmembrane helix prediction 

Transmembrane helices have been predicted in your sequence to adopt the topology shown below