Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAR0
Confidence3.29%DateThu Jan 5 11:13:32 GMT 2012
Rank64Aligned Residues48
% Identity25%Templatec3p8cB_
PDB info PDB header:protein bindingChain: B: PDB Molecule:nck-associated protein 1; PDBTitle: structure and control of the actin regulatory wave complex
Resolution2.29 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40......... 50.........60.........70......
Predicted Secondary structure 



















.



Query SS confidence 







































.


























Query Sequence  DIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLN. ELIEHIATFALNYKIKYNEDNKLIEQI
Query Conservation 









 
    
 

  

  



 

  

 

.






 
   





    
    
Alig confidence 


















...................

.


























Template Conservation 
  




 






   ...................
   
  

   
  
  

 

 
 
   
Template Sequence  DISEMRSLSELLGPYGMKF. . . . . . . . . . . . . . . . . . . LSESLMWHISSQVAELKKLVVENVDVLTQM
Template Known Secondary structure  S...................TT
Template Predicted Secondary structure 


...................
Template SS confidence 



































































   832.......840.........850 .........860.........870.........880
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions