Return to main results Retrieve Phyre Job Id

Job DescriptionP20083
Confidence21.63%DateThu Jan 5 11:37:45 GMT 2012
Rank105Aligned Residues32
% Identity28%Templated1k92a2
SCOP infoArgininosuccinate synthetase, C-terminal domain Argininosuccinate synthetase, C-terminal domain Argininosuccinate synthetase, C-terminal domain
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.........100.........110.....
Predicted Secondary structure 


























Query SS confidence 











































Query Sequence  RGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVG
Query Conservation 




  
    
  




  
 






   
 


 

 
Alig confidence 






.














...........









Template Conservation   
 



.

     
 


  
...........
 


  


Template Sequence  QGHPVAL. NGKTFSDDVEMMLEA. . . . . . . . . . . NRIGGRHGLG
Template Known Secondary structure  TT.TTB

SS...........TTTTT
Template Predicted Secondary structure 

.




...........



Template SS confidence 











































   242...... .250.........260... ......270...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions