Return to main results Retrieve Phyre Job Id

Job DescriptionP24178
Confidence42.13%DateThu Jan 5 11:40:55 GMT 2012
Rank201Aligned Residues31
% Identity23%Templatec2yv7A_
PDB info PDB header:metal transportChain: A: PDB Molecule:cg10997-pa; PDBTitle: crystal structure of the clic homolog from drosophila2 melanogaster
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2....... 10.........20 .........30..
Predicted Secondary structure 


.........
....



Query SS confidence 







. . . . . . . . .










. . . .











Query Sequence  VTLYGIKN. . . . . . . . . CDTIKKARRWL. . . . EANNIDYRFHDY
Query Conservation 
 

    .........
 
 


   
....    
    

 
Alig confidence 







.........










....











Template Conservation    
  

   
    
 


 

  
 
  
 
 
 
  
   
Template Sequence  IELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTV
Template Known Secondary structure  B
TTTSSSB


TTSS
Template Predicted Secondary structure 
















Template SS confidence 











































   23......30.........40.........50.........60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions