Return to main results Retrieve Phyre Job Id

Job DescriptionP77795
Confidence97.13%DateThu Jan 5 12:32:56 GMT 2012
Rank190Aligned Residues32
% Identity19%Templatec2wwwB_
PDB info PDB header:transport proteinChain: B: PDB Molecule:methylmalonic aciduria type a protein, PDBTitle: crystal structure of methylmalonic acidemia type a protein
Resolution2.64 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50. ........
Predicted Secondary structure 









..........







Query SS confidence 























. . . . . . . . . .







Query Sequence  KDGEFFSMLGPSGSGKTTCLRLIA. . . . . . . . . . GFEQLSGG
Query Conservation    

   


 








  
 ..........
   
  
Alig confidence 























..........







Template Conservation       
 


 









 
       
  




 

 
Template Sequence  PLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAVDTE
Template Known Secondary structure 
SS

TTSSTT





Template Predicted Secondary structure 
















Template SS confidence 









































   141........150.........160.........170.........180..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions