Return to main results Retrieve Phyre Job Id

Job DescriptionP77615
Confidence84.21%DateThu Jan 5 12:31:04 GMT 2012
Rank409Aligned Residues27
% Identity22%Templated1ttya_
SCOP infoDNA/RNA-binding 3-helical bundle Sigma3 and sigma4 domains of RNA polymerase sigma factors Sigma4 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40....
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  TIYDIARVAGVSKSTVSRVLNKQTNISPEAREKVLRAIEEL
Query Conservation 

 


  



  






    

  

 

   
 

Alig confidence 















..............










Template Conservation 
  


  



   
..............
    


 

Template Sequence  TLEEVGQYFNVTRERI. . . . . . . . . . . . . . RQIEVKALRKL
Template Known Secondary structure 
T

..............
Template Predicted Secondary structure 



..............
Template SS confidence 








































   352.......360....... ..370........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions