Return to main results Retrieve Phyre Job Id

Job DescriptionP77615
Confidence76.97%DateThu Jan 5 12:31:04 GMT 2012
Rank486Aligned Residues27
% Identity22%Templatec3t72o_
PDB info PDB header:transcription/dnaChain: O: PDB Molecule:pho box dna (strand 1); PDBTitle: phob(e)-sigma70(4)-(rnap-betha-flap-tip-helix)-dna transcription2 activation sub-complex
Resolution4.33 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40....
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  TIYDIARVAGVSKSTVSRVLNKQTNISPEAREKVLRAIEEL
Query Conservation 

 


  



  






    

  

 

   
 

Alig confidence 















..............










Template Conservation 

 


  







..............


   

 

Template Sequence  TLEEVGKQFDVTRERI. . . . . . . . . . . . . . RQIEAKALRKL
Template Known Secondary structure 
SS
..............
Template Predicted Secondary structure 



..............
Template SS confidence 








































   572.......580....... ..590........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions