Return to main results Retrieve Phyre Job Id

Job DescriptionP77615
Confidence78.98%DateThu Jan 5 12:31:04 GMT 2012
Rank465Aligned Residues41
% Identity24%Templatec1p4xA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:staphylococcal accessory regulator a homologue; PDBTitle: crystal structure of sars protein from staphylococcus aureus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20... .... ..30.........40....
Predicted Secondary structure 



...............



....


Query SS confidence 



















. . . . . . . . . . . . . . .



. . . .
















Query Sequence  TIYDIARVAGVSKSTVSRVL. . . . . . . . . . . . . . . NKQT. . . . NISPEAREKVLRAIEEL
Query Conservation 

 


  



  





...............
   .... 

  

 

   
 

Alig confidence 



















...............



....
















Template Conservation 
  


  
  
 
 

  
  
  

 
 
     
 
   
 

  
   
       
Template Sequence  PFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLF
Template Known Secondary structure  SSS
GGGTTTS

SSSTTS

Template Predicted Secondary structure 












Template SS confidence 



























































   52.......60.........70.........80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions