Return to main results Retrieve Phyre Job Id

Job DescriptionP76236
Confidence42.98%DateThu Jan 5 12:21:01 GMT 2012
Rank51Aligned Residues25
% Identity20%Templated1jiha2
SCOP infoDNA/RNA polymerases DNA/RNA polymerases Lesion bypass DNA polymerase (Y-family), catalytic domain
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   421........430.........440.........450.....
Predicted Secondary structure 








Query SS confidence 


































Query Sequence  AKIIAERMRKNVELLTGFSNRYDVPEQMTISIGTV
Query Conservation 
      
   
               

 


  
Alig confidence 













..........










Template Conservation 

 

  

  
  ..........


 






Template Sequence  GSQVCKGIRDSIKD. . . . . . . . . . ILGYTTSCGLS
Template Known Secondary structure  ..........



Template Predicted Secondary structure  ..........



Template SS confidence 


































   241........250.... .....260.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions