Return to main results Retrieve Phyre Job Id

Job DescriptionP76135
Confidence92.72%DateThu Jan 5 12:19:26 GMT 2012
Rank65Aligned Residues45
% Identity29%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   149150.........160.........170.... .....180.........190.........200.........
Predicted Secondary structure 






.










Query SS confidence 

























.


































Query Sequence  HPWKLKDICDCLYISESLLKKKLKQE. QTTFSQILLDARMQHAKNLIRVEGSVNKIAEQCGY
Query Conservation     

  

    

   
 
 

  .
 
    
   

  
  

 
  

 


   

Alig confidence 

























.








................









Template Conservation 
 


 


   


  






    

  

 
................
   
  


Template Sequence  QYGTLASIAAKLGISRTTVSNAYNRPEQLSAELRQR. . . . . . . . . . . . . . . . ILDTAEDMGY
Template Known Secondary structure 
TTTS

GGGS
................TT
Template Predicted Secondary structure 













................

Template SS confidence 





























































   8.10.........20.........30.........40... ......50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions