Return to main results Retrieve Phyre Job Id

Job DescriptionP67701
Confidence23.84%DateThu Jan 5 12:10:49 GMT 2012
Rank218Aligned Residues30
% Identity17%Templated1rfza_
SCOP infoYutG-like YutG-like YutG-like
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   63......70.........80.........90.........100..
Predicted Secondary structure 












Query SS confidence 







































Query Sequence  SAPEFAEFNAMAQAMPGGIAVIRTLMDQYGLTLSDLPEIG
Query Conservation                 
  

 

 


  



 




 
Alig confidence 








..........




















Template Conservation           ..........      
  




 


   
Template Sequence  SEFIXNNLE. . . . . . . . . . QTARRWLEERGVTVEKIAELV
Template Known Secondary structure  TS
..........TT

Template Predicted Secondary structure 

..........



Template SS confidence 







































   2.......10 .........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions