Return to main results Retrieve Phyre Job Id

Job DescriptionP77739
Confidence77.69%DateThu Jan 5 12:32:23 GMT 2012
Rank274Aligned Residues23
% Identity22%Templatec3ek7A_
PDB info PDB header:fluorescent proteinChain: A: PDB Molecule:myosin light chain kinase, green fluorescent PDBTitle: calcium-saturated gcamp2 dimer
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200..... .. ..210.
Predicted Secondary structure 








............

Query SS confidence 
















. . . .

. . . . . . . .



Query Sequence  LLHGDLWSGNCALGPDG. . . . PY. . . . . . . . IFDP
Query Conservation 





   


     ....  ........


 
Alig confidence 
















....

........



Template Conservation 
 




 

            
          
 
Template Sequence  AIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDG
Template Known Secondary structure 



GGGTBTTS
Template Predicted Secondary structure 



























Template SS confidence 


































   53......60.........70.........80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions