Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA63
Confidence13.38%DateThu Jan 5 11:12:02 GMT 2012
Rank1Aligned Residues32
% Identity19%Templated2osoa1
SCOP infoLigand-binding domain in the NO signalling and Golgi transport Ligand-binding domain in the NO signalling and Golgi transport MJ1460-like
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   83......90.........100.........110.........120...
Predicted Secondary structure 





Query SS confidence 








































Query Sequence  CWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHKHGL
Query Conservation    
 
 


  
                         
 
 
Alig confidence 














.........
















Template Conservation     

  

 


 
.........     


  

     
Template Sequence  ETSLYEIGEEFGKXL. . . . . . . . . SPKNIEELKKIFKLXNF
Template Known Secondary structure 


.........

SST
Template Predicted Secondary structure 

.........



Template SS confidence 








































   4950.........60... ......70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions