Return to main results Retrieve Phyre Job Id

Job DescriptionP25519
Confidence96.77%DateThu Jan 5 11:41:54 GMT 2012
Rank319Aligned Residues37
% Identity24%Templatec1z47B_
PDB info PDB header:ligand binding proteinChain: B: PDB Molecule:putative abc-transporter atp-binding protein; PDBTitle: structure of the atpase subunit cysa of the putative2 sulfate atp-binding cassette (abc) transporter from3 alicyclobacillus acidocaldarius
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   199200.........210.........220.........230.........240.......
Predicted Secondary structure 
















Query SS confidence 
















































Query Sequence  TVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVADVGET
Query Conservation   




 









 


  
 
 
  
 


   
 
    
  
Alig confidence 




















...........










.




Template Conservation     


 








  
 
...........
  
  
 
  . 
  
Template Sequence  MVGLLGPSGSGKTTILRLIAG. . . . . . . . . . . LERPTKGDVWI. GGKRV
Template Known Secondary structure 
STTSST...........SS

S.TT
Template Predicted Secondary structure 






...........






.


Template SS confidence 
















































   43......50.........60... ......70.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions