Return to main results Retrieve Phyre Job Id

Job DescriptionP76071
Confidence8.68%DateThu Jan 5 12:18:09 GMT 2012
Rank19Aligned Residues48
% Identity27%Templated1k78a1
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like Paired domain
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........90.........100.........110......
Predicted Secondary structure 

























Query SS confidence 


































































Query Sequence  NGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQ
Query Conservation   


      
  



     



 
            
 
       

 


 


 

    
Alig confidence 


.














.














.................














Template Conservation   

.


 
 
 


 
  . 
 
   




 

................. 
 




 

 


Template Sequence  NGR. PLPDVVRQRIVELAH. QGVRPCDISRQLRVS. . . . . . . . . . . . . . . . . HGCVSKILGRYYETG
Template Known Secondary structure  TTS.


.TT

T

.................S
Template Predicted Secondary structure 


.


.






.................
Template SS confidence 


































































   2930. ........40...... ...50.........60. ........70......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions