Return to main results Retrieve Phyre Job Id

Job DescriptionP08956
Confidence74.21%DateThu Jan 5 11:01:43 GMT 2012
Rank461Aligned Residues62
% Identity19%Templatec1y88A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein af1548; PDBTitle: crystal structure of protein of unknown function af1548
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   247..250.........260.........270.........280.........290.........300.........310.........320......
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  FLIDAQLRKAGWQADSKTLRFSKGARPEPGVNKAIAEWPTGKDETGNQGFADYVLFVGLKPIAVVEAKRNNIDVPARLNE
Query Conservation   


  
  


              
         
              




 

 








          
Alig confidence 
















......................






















.
















Template Conservation   


 


  

 

  ......................
 
   


 





 
     . 



       

   
Template Sequence  HMVARLLEEHGFETKTN. . . . . . . . . . . . . . . . . . . . . . VIVQGNCVEQEIDVVAERDGERY. MIECKFHNIPVYTGLKE
Template Known Secondary structure  TTT
......................
SSSTT.


SSS

Template Predicted Secondary structure 




......................









.







Template SS confidence 















































































   910.........20..... ....30.........40........ .50.........60.....
 
   327..330.
Predicted Secondary structure 
Query SS confidence 




Query Sequence  SYRYS
Query Conservation     

Alig confidence 




Template Conservation 
    
Template Sequence  AMYTY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 




   66...70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions