Return to main results Retrieve Phyre Job Id

Job DescriptionP77790
Confidence8.03%DateThu Jan 5 12:32:53 GMT 2012
Rank33Aligned Residues38
% Identity16%Templatec3lklB_
PDB info PDB header:transport proteinChain: B: PDB Molecule:antisigma-factor antagonist stas; PDBTitle: crystal structure of the c-terminal domain of anti-sigma factor2 antagonist stas from rhodobacter sphaeroides
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.........60.......
Predicted Secondary structure 

























Query SS confidence 




















































Query Sequence  PDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLSGLQLVIY
Query Conservation 
 
  





  

 
  

      
   

 

  
   
   
  
 
 
Alig confidence 










...............


























Template Conservation    



 
 
 ............... 




   
  
       
  
 
 
Template Sequence  ERVTIDVSRAH. . . . . . . . . . . . . . . IWDISSVQALDXAVLKFRREGAEVRIV
Template Known Secondary structure  S...............
ST
Template Predicted Secondary structure 




...............



Template SS confidence 




















































   41........50. ........60.........70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions