Return to main results Retrieve Phyre Job Id

Job DescriptionP30870
Confidence15.27%DateThu Jan 5 11:46:43 GMT 2012
Rank57Aligned Residues34
% Identity38%Templatec2xvcA_
PDB info PDB header:cell cycleChain: A: PDB Molecule:escrt-iii; PDBTitle: molecular and structural basis of escrt-iii recruitment to2 membranes during archaeal cell division
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   850.........860.........870.........880.........890...
Predicted Secondary structure 
















Query SS confidence 











































Query Sequence  GGITDIEFITQYLVLRYAHEKPKLTRWSDNVRILELLAQNDIME
Query Conservation 


 



 

 
 
  
   
 
   
 
   
  
   
 
 
Alig confidence 











....







......













Template Conservation 

 


      ....


 
 

......   
  
  




Template Sequence  GGFLDIEHFSKV. . . . YGVEKQEV. . . . . . VKLLEALKNKGLIA
Template Known Secondary structure  TS


....


......TTS

Template Predicted Secondary structure 

....


......


Template SS confidence 











































   223......230.... .....240.. .......250......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions