Return to main results Retrieve Phyre Job Id

Job DescriptionP69937
Confidence0.68%DateThu Jan 5 12:12:25 GMT 2012
Rank89Aligned Residues31
% Identity35%Templated3ehbb2
SCOP infoTransmembrane helix hairpin Cytochrome c oxidase subunit II-like, transmembrane region Cytochrome c oxidase subunit II-like, transmembrane region
Resolution2.32

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50....
Predicted Secondary structure 






Query SS confidence 










































Query Sequence  LEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLP
Query Conservation   

  
  

 
 

      
        

  

 

  

Alig confidence 






...........
















.






Template Conservation 






...........

 


  

 


  
.
  

 
Template Sequence  IEVIWTL. . . . . . . . . . . VPVLILVAIGAFSLPIL. FRSQEMP
Template Known Secondary structure  ............S

Template Predicted Secondary structure  ............



Template SS confidence 










































   77..80... ......90.........100 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions