Return to main results Retrieve Phyre Job Id

Job DescriptionP77671
Confidence31.01%DateThu Jan 5 12:31:31 GMT 2012
Rank177Aligned Residues23
% Identity13%Templatec3isyA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:intracellular proteinase inhibitor; PDBTitle: crystal structure of an intracellular proteinase inhibitor (ipi,2 bsu11130) from bacillus subtilis at 2.61 a resolution
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   383......390.........400.........410.........420.........430
Predicted Secondary structure 






















Query SS confidence 















































Query Sequence  GKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGD
Query Conservation 
  






 
                           
  


 
 
Alig confidence 











.........................










Template Conservation 

  

 
 
  .........................
  
  

   
Template Sequence  GQKFELVVYDSE. . . . . . . . . . . . . . . . . . . . . . . . . HKERYRYSKEK
Template Known Secondary structure  S


TT.........................

TTTT
Template Predicted Secondary structure 




.........................





Template SS confidence 















































   40.........50. ........60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions