Return to main results Retrieve Phyre Job Id

Job DescriptionP77779
Confidence9.14%DateThu Jan 5 12:32:45 GMT 2012
Rank20Aligned Residues31
% Identity32%Templatec3lhrA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:zinc finger protein 24; PDBTitle: crystal structure of the scan domain from human znf24
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   369370.........380...... ...390.........
Predicted Secondary structure 








..........




Query SS confidence 

















. . . . . . . . . .












Query Sequence  SSAPNVFKTFFRALSPYD. . . . . . . . . . YTLYCRKWVKPNL
Query Conservation                    ..........             
Alig confidence 

















..........












Template Conservation     

  




 
 
 
   
 
 
  
  

  




 
Template Sequence  SPDPEIFRQRFRQFGYQDSPGPREAVSQLRELCRLWLRPET
Template Known Secondary structure 
S

GGGSSS
TTT
Template Predicted Secondary structure 
















Template SS confidence 








































   2.......10.........20.........30.........40..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions