Return to main results Retrieve Phyre Job Id

Job DescriptionP0C077
Confidence1.99%DateThu Jan 5 11:29:47 GMT 2012
Rank82Aligned Residues39
% Identity23%Templatec1wsuA_
PDB info PDB header:translation/rnaChain: A: PDB Molecule:selenocysteine-specific elongation factor; PDBTitle: c-terminal domain of elongation factor selb complexed with2 secis rna
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........60...
Predicted Secondary structure 


















Query SS confidence 
























































Query Sequence  FDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLV
Query Conservation      
 
 
 

       
   
  
   
    
 
         




 



Alig confidence 



























..................










Template Conservation 

 

 

 

 









 

  
.................. 


 

 


Template Sequence  FGLAEARDALGSSRKYVLPLLEYLDQVK. . . . . . . . . . . . . . . . . . FTRRVGDKRVV
Template Known Secondary structure  B
T

TT..................STT
Template Predicted Secondary structure 






..................


Template SS confidence 
























































   593......600.........610.........620 .........630.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions