Return to main results Retrieve Phyre Job Id

Job DescriptionP77381
Confidence11.63%DateThu Jan 5 12:28:25 GMT 2012
Rank95Aligned Residues35
% Identity23%Templated1n62c1
SCOP infoCO dehydrogenase flavoprotein C-domain-like CO dehydrogenase flavoprotein C-terminal domain-like CO dehydrogenase flavoprotein C-terminal domain-like
Resolution1.09

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30........ .40.........
Predicted Secondary structure 





.............
Query SS confidence 























. . . . . . . . . . . . .










Query Sequence  DVDIIRRAYLALLPSFHPETDPQG. . . . . . . . . . . . . FKQLRQAYEEA
Query Conservation 
   




  

   







.............










Alig confidence 























.............










Template Conservation         
         
  
 
 
  


 
   
  


  
  

Template Sequence  DKPALDKAVALAEAITAPASDGRGPAEYRTKMAGVMLRRAVERAKARA
Template Known Secondary structure 





BTTB

Template Predicted Secondary structure 












Template SS confidence 















































   239240.........250.........260.........270.........280......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions