Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6B4
Confidence6.39%DateThu Jan 5 11:02:45 GMT 2012
Rank99Aligned Residues21
% Identity43%Templated1o75a1
SCOP infoImmunoglobulin-like beta-sandwich Tp47 lipoprotein, middle and C-terminal domains Tp47 lipoprotein, middle and C-terminal domains
Resolution1.95

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   247..250.........260.........270......
Predicted Secondary structure 















Query SS confidence 





























Query Sequence  HKAGEPVGYGGTWVSERDTRLGVVAMGYGD
Query Conservation 
  
  



          

 
 


 
Alig confidence 








.........











Template Conservation    
 




.........
 







 
Template Sequence  RFKGSGPGY. . . . . . . . . YRLTLIANGYRD
Template Known Secondary structure  GGTT

S.........TTS

Template Predicted Secondary structure 







.........


Template SS confidence 





























   304.....310.. .......320....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions