Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6B4
Confidence6.81%DateThu Jan 5 11:02:45 GMT 2012
Rank90Aligned Residues24
% Identity21%Templated1j98a_
SCOP infoLuxS/MPP-like metallohydrolase LuxS/MPP-like metallohydrolase Autoinducer-2 production protein LuxS
Resolution1.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   123... ...130.. .......140......
Predicted Secondary structure 

.





........
Query SS confidence 



.





. . . . . . . .













Query Sequence  LDTG. MHRLGV. . . . . . . . RPEQAEAFYHRLTQ
Query Conservation 



.
 
 
 ........   
       
  
Alig confidence 



.





........













Template Conservation 

 



 




   
      
       
 
Template Sequence  IDISPMGQTGYYLVVSGETTSAEIVDLLEDTMK
Template Known Secondary structure 






Template Predicted Secondary structure 










Template SS confidence 
































   77..80.........90.........100.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions