Return to main results Retrieve Phyre Job Id

Job DescriptionP26616
Confidence77.22%DateThu Jan 5 11:43:01 GMT 2012
Rank264Aligned Residues34
% Identity24%Templatec3lzxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase 2; PDBTitle: crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus2 subtilis (form ii)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   294... ..300.........310.........320.........330........
Predicted Secondary structure 

...










Query SS confidence 



. . .








































Query Sequence  SEKK. . . IVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRF
Query Conservation   
 
...

  





 


  
       


 


   
  

  
Alig confidence 



...






















...........






Template Conservation       












 

  
   
  ...........
 



 
Template Sequence  EDTKVYDITIIGGGPVGLFTAFYGGMRQAS. . . . . . . . . . . VKIIESL
Template Known Secondary structure 

STT

...........
SS
Template Predicted Secondary structure 









...........

Template SS confidence 















































   3......10.........20.........30.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions