Return to main results Retrieve Phyre Job Id

Job DescriptionP26616
Confidence72.67%DateThu Jan 5 11:43:01 GMT 2012
Rank302Aligned Residues31
% Identity19%Templatec3gmbB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:2-methyl-3-hydroxypyridine-5-carboxylic acid PDBTitle: crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic2 acid oxygenase
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   297..300.........310.........320.........330........
Predicted Secondary structure 










Query SS confidence 









































Query Sequence  KIVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRF
Query Conservation 


  





 


  
       


 


   
  

  
Alig confidence 























...........






Template Conservation   
 




 


  
  

  
  ...........
 
 

 
Template Sequence  RAEVAGGGFAGLTAAIALKQNGWD. . . . . . . . . . . VRLHEKS
Template Known Secondary structure 

STT
...........SS
Template Predicted Secondary structure 





...........

Template SS confidence 









































   13......20.........30...... ...40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions