Return to main results Retrieve Phyre Job Id

Job DescriptionP26616
Confidence61.13%DateThu Jan 5 11:43:01 GMT 2012
Rank451Aligned Residues32
% Identity28%Templatec2olnA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nikd protein; PDBTitle: nikd, an unusual amino acid oxidase essential for2 nikkomycin biosynthesis: closed form at 1.15 a resolution
Resolution1.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   298.300.........310.........320.........330.........340
Predicted Secondary structure 












Query SS confidence 










































Query Sequence  IVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGL
Query Conservation 

  





 


  
       


 


   
  

  

Alig confidence 






















...........








Template Conservation 







 


 
  

  
  ...........
 


    
Template Sequence  VVVVGGGPVGLATAWQVAERGHR. . . . . . . . . . . VLVLERHTF
Template Known Secondary structure 

STT

...........SS
T
Template Predicted Secondary structure 




...........



Template SS confidence 










































   7..10.........20......... 30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions