Return to main results Retrieve Phyre Job Id

Job DescriptionP27835
Confidence10.15%DateThu Jan 5 11:44:12 GMT 2012
Rank7Aligned Residues30
% Identity30%Templatec3d9wA_
PDB info PDB header:transferaseChain: A: PDB Molecule:putative acetyltransferase; PDBTitle: crystal structure analysis of nocardia farcinica arylamine2 n-acetyltransferase
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   390.........400.........410.........420.........430....
Predicted Secondary structure 

Query SS confidence 












































Query Sequence  AIFNMIVLAREGLDSFVSRVVFFIVVFGACLMIAKLLYWLFESAG
Query Conservation    

 


 


 





  

  

  
 
 






 



Alig confidence 











...............

















Template Conservation   
  


   

...............




 
 

  

  

Template Sequence  TLQDKLVHSRRG. . . . . . . . . . . . . . . GYCYENAGLFAAALERLG
Template Known Secondary structure  TSSS

...............B
TT
Template Predicted Secondary structure 



...............




Template SS confidence 












































   68.70......... 80.........90.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions