Return to main results Retrieve Phyre Job Id

Job DescriptionP76485
Confidence3.87%DateThu Jan 5 12:23:31 GMT 2012
Rank40Aligned Residues32
% Identity31%Templatec2v4oB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:multifunctional protein sur e; PDBTitle: crystal structure of salmonella typhimurium sure at 2.752 angstrom resolution in monoclinic form
Resolution2.71 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.........70...
Predicted Secondary structure 


























Query SS confidence 



















































Query Sequence  TPRPLLSLEDFFIDNNIHGSICCNVIPEQSPQAIYHHFLKIRERNNVSDVLV
Query Conservation   
 








 

  




 
    
    

  
  
     
  
 
Alig confidence 






........



......















......




Template Conservation   





........



......
 



  
   
   ......
 
 
Template Sequence  SMRILLS. . . . . . . . NDDG. . . . . . VHAPGIQTLAKALREF. . . . . . ADVQV
Template Known Secondary structure 

........
SS
......TT
TTT......S
Template Predicted Secondary structure 

........



......




......

Template SS confidence 



















































   0...... ...10 .........20...... ...30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions