Return to main results Retrieve Phyre Job Id

Job DescriptionP76485
Confidence4.08%DateThu Jan 5 12:23:31 GMT 2012
Rank37Aligned Residues31
% Identity29%Templatec2e6gI_
PDB info PDB header:hydrolaseChain: I: PDB Molecule:5'-nucleotidase sure; PDBTitle: crystal structure of the stationary phase survival protein sure from2 thermus thermophilus hb8 in complex with phosphate
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 


















































Query Sequence  PRPLLSLEDFFIDNNIHGSICCNVIPEQSPQAIYHHFLKIRERNNVSDVLV
Query Conservation 
 








 

  




 
    
    

  
  
     
  
 
Alig confidence 





........



......

















......


Template Conservation 
 



........



......
 



 

  

   
 ......
 
Template Sequence  MRILVT. . . . . . . . NDDG. . . . . . IYSPGLWALAEAASQFGE. . . . . . VFV
Template Known Secondary structure 
........
SS
......TT
GGGS......
Template Predicted Secondary structure 
........



......






......
Template SS confidence 


















































   1..... ...10 .........20........ .30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions