Return to main results Retrieve Phyre Job Id

Job DescriptionP76485
Confidence5.43%DateThu Jan 5 12:23:31 GMT 2012
Rank26Aligned Residues42
% Identity29%Templatec2da1A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:alpha-fetoprotein enhancer binding protein; PDBTitle: solution structure of the first homeobox domain of at-2 binding transcription factor 1 (atbf1)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60.........70.........80.........90.........100
Predicted Secondary structure 









































Query SS confidence 















































































Query Sequence  DTPRPLLSLEDFFIDNNIHGSICCNVIPEQSPQAIYHHFLKIRERNNVSDVLVEITMFDDPDWPFSESILVITTASPEEV
Query Conservation    
 








 

  




 
    
    

  
  
     
  
 
 
 
 

  






 
 


   

Alig confidence 















...........















...............................





Template Conservation   
  
   

  
   ...........  
       

    ...............................
    
Template Sequence  ITDDQLRVLRQYFDIN. . . . . . . . . . . NSPSEEQIKEMADKSG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LPQKVI
Template Known Secondary structure 


...........SS

TT
...............................

Template Predicted Secondary structure 


...........




...............................

Template SS confidence 















































































   14.....20......... 30.........40..... ....50.
 
   101...
Predicted Secondary structure 
Query SS confidence 



Query Sequence  QSWF
Query Conservation    
 
Alig confidence 



Template Conservation    

Template Sequence  KHWF
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   52...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions