Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEY5
Confidence46.93%DateThu Jan 5 11:24:38 GMT 2012
Rank80Aligned Residues31
% Identity26%Templatec3crnA_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:response regulator receiver domain protein, chey-like; PDBTitle: crystal structure of response regulator receiver domain protein (chey-2 like) from methanospirillum hungatei jf-1
Resolution1.58 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40..
Predicted Secondary structure 












Query SS confidence 









































Query Sequence  MSNILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDVRIV
Query Conservation 






 


    
   
   
              
   
Alig confidence 











...........


















Template Conservation 
 






   ...........    
   
   
  
  
Template Sequence  LKRILIVDDDTA. . . . . . . . . . . ILDSTKQILEFEGYEVEIA
Template Known Secondary structure 


S
...........TT
Template Predicted Secondary structure 




...........


Template SS confidence 









































   1........10.. .......20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions