Return to main results Retrieve Phyre Job Id

Job DescriptionP76243
Confidence9.48%DateThu Jan 5 12:21:10 GMT 2012
Rank21Aligned Residues27
% Identity19%Templatec2xznT_
PDB info PDB header:ribosomeChain: T: PDB Molecule:rps19e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 2
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42....... 50.........60........
Predicted Secondary structure 





..........




Query SS confidence 







. . . . . . . . . .


















Query Sequence  KEITPSTE. . . . . . . . . . LRKAFHGEVVDYATFREQY
Query Conservation 
 



 
..........




 
      

  

Alig confidence 







..........


















Template Conservation 




   

 
 
 


 
 



  


  
   
Template Sequence  RELAPQDSDWVYIRTAALARKVYLKPHTGISTLKHIF
Template Known Secondary structure 
SS

SSTTSTT

T
Template Predicted Secondary structure 













Template SS confidence 




































   47..50.........60.........70.........80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions