Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7M9
Confidence4.09%DateThu Jan 5 11:05:57 GMT 2012
Rank87Aligned Residues30
% Identity13%Templated1jmxa1
SCOP infoCytochrome c Cytochrome c Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40. ........50.........60......
Predicted Secondary structure 



.........










Query SS confidence 




. . . . . . . . .
























Query Sequence  CSKCH. . . . . . . . . PFFTGKQRDVATGGRVDRFNKRFNI
Query Conservation   
  
.........




 
  


 





 



 
Alig confidence 




.........
























Template Conservation 
  


   
    

   
 

  
   
 

    

Template Sequence  CMGCHIPEGNDTYSRISHQRKTPEGWLMSIARMQVMHGL
Template Known Secondary structure  BTTB
TTTTGGG





Template Predicted Secondary structure 











Template SS confidence 






































   12.......20.........30.........40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions