Return to main results Retrieve Phyre Job Id

Job DescriptionP14565
Confidence96.45%DateWed Jan 25 15:20:38 GMT 2012
Rank197Aligned Residues39
% Identity36%Templated1e32a2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   971........980. ........990.........1000.........
Predicted Secondary structure  ..............









Query SS confidence 










. . . . . . . . . . . . . .



























Query Sequence  SGQRAATRMIL. . . . . . . . . . . . . . ETSDRFTVVQGYAGVGKTTQFRAVMSAV
Query Conservation    
  

  

..............

 

   
 
 






 
 

   
Alig confidence 










..............



























Template Conservation     
  
   
                    


 







 

  

   
Template Sequence  RKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANET
Template Known Secondary structure  S









TTSST
Template Predicted Secondary structure 
















Template SS confidence 




















































   210.........220.........230.........240.........250.........260..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions