Return to main results Retrieve Phyre Job Id

Job DescriptionA5A605
Confidence4.30%DateThu Jan 5 10:55:14 GMT 2012
Rank52Aligned Residues25
% Identity24%Templatec1zgwA_
PDB info PDB header:transcription regulator/dnaChain: A: PDB Molecule:ada polyprotein; PDBTitle: nmr structure of e. coli ada protein in complex with dna
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.......
Predicted Secondary structure 








Query SS confidence 
































Query Sequence  FMAILFFPAFNASLFFTGVKPLYSIIKCSTEIF
Query Conservation 


























 
  
 
Alig confidence 



















........




Template Conservation    
   

   

 
   
 ........



 
Template Sequence  WQSVLARDPNADGEFVFAVR. . . . . . . . TTGIF
Template Known Secondary structure  T
TTTBTTBT........TTTB
Template Predicted Secondary structure 









........




Template SS confidence 
































   13......20.........30.. .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions