Return to main results Retrieve Phyre Job Id

Job DescriptionP69428
Confidence3.32%DateThu Jan 5 12:11:35 GMT 2012
Rank57Aligned Residues27
% Identity11%Templatec2fb6A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved hypothetical protein; PDBTitle: structure of conserved protein of unknown function bt1422 from2 bacteroides thetaiotaomicron
Resolution1.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........
Predicted Secondary structure 
Query SS confidence 
































Query Sequence  VLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPK
Query Conservation 





 






 


 
  


   
    
Alig confidence 






.






.....












Template Conservation 

 



. 

 


.....  
   
  
   
Template Sequence  IILWGAS. VKLVAND. . . . . TQVQTEILEXLQS
Template Known Secondary structure 
S.
.....
Template Predicted Secondary structure 


.

.....
Template SS confidence 
































   41...... ..50.... .....60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions