Return to main results Retrieve Phyre Job Id

Job DescriptionP24202
Confidence94.76%DateThu Jan 5 11:41:11 GMT 2012
Rank8Aligned Residues62
% Identity15%Templated1r7ja_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Archaeal DNA-binding protein
Resolution1.47

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  KFIEPVLRYLATKPEGAAARDVHEAAADALGLDDSQRAKVITSGQLVYKNRAGWAHDRLKRAGLSQSLSRGKWCLTPAGF
Query Conservation      


  
   
     


   
     


 
      

      

 

   
 




    

   

  

Alig confidence 











.


......



















...............









.











Template Conservation 


 


     .   ...... 
 
   


       

 ............... 
   


  .    
 




 
Template Sequence  EIIQAILEACKS. GSP. . . . . . KTRIMYGANLSYALTGRYIK. . . . . . . . . . . . . . . MLMDLEIIRQ. EGKQYMLTKKGE
Template Known Secondary structure  TT.
B
......T

...............TTS.TT
Template Predicted Secondary structure 
.


......


...............


.



Template SS confidence 















































































   8.10......... 20.. .......30.........40.. .......50.. .......60....
 
   88.90..
Predicted Secondary structure 
Query SS confidence 




Query Sequence  DWVAS
Query Conservation    
  
Alig confidence 




Template Conservation    
  
Template Sequence  ELLED
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 




   65....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions