Return to main results Retrieve Phyre Job Id

Job DescriptionP24202
Confidence45.60%DateThu Jan 5 11:41:11 GMT 2012
Rank74Aligned Residues60
% Identity30%Templatec2fa5B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator marr/emrr family; PDBTitle: the crystal structure of an unliganded multiple antibiotic-2 resistance repressor (marr) from xanthomonas campestris
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  EPVLRYLATKPEGAAARDVHEAAADALGLDDSQRAKVITSGQLVYKNRAGWAHDRLKRAGLSQSLSRGKWCLTPAGFDWV
Query Conservation   


  
   
     


   
     


 
      

      

 

   
 




    

   

  

  
Alig confidence 











.














...................















..














Template Conservation    

  
     . 
  


       
...................


  
  
   


 ..
     

  
    
Template Sequence  WRVITILALYPG. SSASEVSDRTAXDKV. . . . . . . . . . . . . . . . . . . AVSRAVARLLERGFIR. . RESXLALSPAGRQVY
Template Known Secondary structure  STT.

T

...................TS..



Template Predicted Secondary structure 


.




...................




..


Template SS confidence 















































































   52.......60... ......70........ .80.........90.... .....100.........
 
   91.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  AS
Query Conservation    
Alig confidence 

Template Conservation    
Template Sequence  ET
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   118.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions