Return to main results Retrieve Phyre Job Id

Job DescriptionP24202
Confidence74.47%DateThu Jan 5 11:41:11 GMT 2012
Rank45Aligned Residues62
% Identity26%Templatec2ev5B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator mntr; PDBTitle: bacillus subtilis manganese transport regulator (mntr)2 bound to calcium
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.........70.........80...
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  PTYDKFIEPVLRYLATKPEGAAARDVHEAAADALGLDDSQRAKVITSGQLVYKNRAGWAHDRLKRAGLSQSLSRGKWCLT
Query Conservation 
       


  
   
     


   
     


 
      

      

 

   
 




    

   

Alig confidence 















.







....
















...............










....



Template Conservation   
 



  
  
   .   
    ....

  
 
   


  
 ............... 
   


 
 ....  

Template Sequence  PSMEDYIEQIYMLIEE. KGYARVSD. . . . IAEALAVHPSSVTKMVQ. . . . . . . . . . . . . . . KLDKDEYLIYG. . . . LVLT
Template Known Secondary structure 
.SS

....T

...............TTS

....

Template Predicted Secondary structure 

.




....


...............




....



Template SS confidence 















































































   4.....10......... 20....... ..30.........40.... .....50..... ....
 
   84.....
Predicted Secondary structure 
Query SS confidence 





Query Sequence  PAGFDW
Query Conservation    

  
Alig confidence 





Template Conservation    
   
Template Sequence  SKGKKI
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 





   64.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions