Return to main results Retrieve Phyre Job Id

Job DescriptionP77688
Confidence90.53%DateThu Jan 5 12:31:38 GMT 2012
Rank230Aligned Residues57
% Identity18%Templatec2dg6A_
PDB info PDB header:gene regulationChain: A: PDB Molecule:putative transcriptional regulator; PDBTitle: crystal structure of the putative transcriptional regulator sco55502 from streptomyces coelicolor a3(2)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.........70.........80.........90.........100. ..
Predicted Secondary structure 

























.
Query SS confidence 












































































.

Query Sequence  VSKACKIMGVSRDTFYRYRELVAEGGVDAQINRSRRAPNLKNRTDEATEQAVVDYAVAFPTHGQHRASNELRKQGVF. IS
Query Conservation      
  



  

 

  

   
  

                     
  
               
   

 .

Alig confidence 



















.......






........................


















.

Template Conservation 
 


  








 
  ....... 


 
 ........................
    
 

 

  
   
 
 
Template Sequence  LADLSKRSGVSTATIKYYLR. . . . . . . EGLLPPG. . . . . . . . . . . . . . . . . . . . . . . . YDEDHLRRLRLVRALIQVGKVP
Template Known Secondary structure  T

.......TSS


........................

TT


Template Predicted Secondary structure 


.......






........................






Template SS confidence 















































































   3......10.........20.. ....... 30.........40.........50.
 
   104.....110..
Predicted Secondary structure 
Query SS confidence 








Query Sequence  DSGVRSVWL
Query Conservation    

 


 
Alig confidence 








Template Conservation 
  

  
 
Template Sequence  VATAREVLG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 








   61........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions