Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADN0
Confidence29.44%DateThu Jan 5 11:21:24 GMT 2012
Rank53Aligned Residues93
% Identity13%Templatec3nzxK_
PDB info PDB header:hydrolase/hydrolase inhibitorChain: K: PDB Molecule:proteasome component pre2; PDBTitle: crystal structure of the yeast 20s proteasome in complex with ligand2 2c
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   317..320.........330.........340.........350.........360.........370.........380.........390......
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  QPRGPFIVCVDTSGSMGGFNEQCAKAFCLALMRIALAENRRCYIMLFSTEIVRYELSGPQGIEQAIRFLSQQFRGGTDLA
Query Conservation    













 
 

  


 




  

 
 
   

 


      
           

     




 
Alig confidence 


















..................................


























Template Conservation        

  
  

    ..................................   


 
       

         
Template Sequence  RKEGPTIYYVDSDGTRLKG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DIFCVGSGQTFAYGVLDSNYKWDLSVE
Template Known Secondary structure  TTTTTS

..................................SSTTTT

TT

Template Predicted Secondary structure 







..................................








Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions